PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT12195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 258aa    MW: 29572.3 Da    PI: 6.5186
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT12195genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.8e-13142188147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g WT+eE+ l++++    G g Wk I++++ + Rt+ q+ s+ qky
         EMT12195 142 KGFWTPEEHRLFLHGLSVCGRGKWKEISKYFVTSRTPAQISSHAQKY 188
                      688*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.613137193IPR017930Myb domain
SuperFamilySSF466892.83E-16140194IPR009057Homeodomain-like
SMARTSM007175.1E-10141191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-11142188IPR009057Homeodomain-like
PfamPF002494.2E-10143188IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.1E-13144191IPR006447Myb domain, plants
CDDcd001671.24E-8145189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MNQRVNQEWN PSEVEGARSI IARLNNYYNN DGTNHEKNKK HDIMANLKAC FPRKTMQQWP  60
EKEYNGSNSD HGVIYTVDGL VNKNFGLQEE VSMEGMGILF GLPLESMQTM EIQEEVQMVE  120
ENKVVLENKM CIPQPVLAPR AKGFWTPEEH RLFLHGLSVC GRGKWKEISK YFVTSRTPAQ  180
ISSHAQKYFM RLQRKGSGSQ RYSINDVELD DAGPWKMENS FNFWQELALQ STTGGDNKNP  240
SFDLQTPSSP FVTMNNIV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752587.12e-72PREDICTED: uncharacterized protein LOC100829132
TrEMBLM8BES10.0M8BES1_AEGTA; Myb-like protein J
STRINGMLOC_16598.11e-149(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.21e-20MYB_related family protein